Spectramax 384. Absorbance Detection Cartridges combine scanning and broad spectrum wavelength range to address a variety of nucleic acids, proteins, ELISAs and immunoassays found in the laboratory. Spectramax 384

 
 Absorbance Detection Cartridges combine scanning and broad spectrum wavelength range to address a variety of nucleic acids, proteins, ELISAs and immunoassays found in the laboratorySpectramax 384  For more sample throughput, the system can be

Select ‘Water Constant’ in the Instrument Settings dialog box (Figure 3). Use any standard cuvette, 12 x 75 mm test tube, 96- or 384-well. Figure 1. Temperature range between 4°C above ambient to 45°C. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax M Series Multi-Mode Microplate Readers 3. SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. For more information, please visit us at Devices – Spectramax Gemini XS plate reader (Fluorescence) Molecular Devices – Spectramax 384 plus plate reader (UV/VIS) Invitrogen by Life technologies Qubit 2. ¨The SpectraMax M2 is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. E = absorptivity (extinction coefficient) C = concentration = pathlength. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time. Products : General, Microplate Readers. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Detection of species collected on membrane plates is also. Labsystems Nepheloskan Ascent Microplate Reader. The SpectraMax® Paradigm® Multi-Mode Microplate Reader measures absorbance, fluorescence, time-resolved fluorescence (including HTRF), fluorescence polarization, AlphaScreen®, AlphaLISA®, and luminescence assays for up to 1536-well plates. Compare. Multimode Reader Comparison Chart. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. ) 8. It measures the optical density (OD) of samples in both 96- and 384-well microplates at a selected wavelength for a single point in timeSpectraMax®Plus384 SpectraMax®190 SpectraMax®340PC384. Normally this fluorometric assay is performed in 96-well microplates. SpectraMax L Microplate Reader is a sensitive luminometer with programmable injector options that measures flash and glow luminescence assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) in 96- and 384-well plates. both cuvette-based and microplate reader applications on the same instrument. Products : SpectraMax Plus 384 reader, SpectraMax 190 reader, SpectraMax 340PC 384 (Obsolete), SpectraMax 250 (Obsolete), SpectraMax 340 (Obsolete), VersaMax reader How does stray light affect my OD reading? The basic problem caused by stray light (light you don't want, getting into the read) is a falsely low OD seen. Here, the CVs for each plate were less than 3, and the difference between mean onset time for the plates run on the two readers was only 7%. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Cables. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Typical applications for this powerful reader include DNA and RNA quantification. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Also refer to this Multimode Reader Comparison Chart. The guidelines for cuvette use in SpectraMax instruments are the same as those that apply to any high-quality spectrophotometer. Trilux 1450 Microbeta Liquid Scintillation and Luminescence Counter, Wallac (CAT#: STEM-SPO-0385-ZJF) Dynex MRX TC Revelation Microplate Reader, 100-240V, Dynex Technologies (CAT#: STEM-SPO-0076-YJL)The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Page 78 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. Supplier: Molecular Devices. Molecular Devices Spectramax Plus 384 Microplate Reader is available from The Lab World Group. 1. More Product Information. You can use 6, 12, 24, 48, 96, and 384-well plates that conform to ANSI/SBS standard microplate footprint and dimensions in the instrument. 0. Molecular Devices would like to introduce to you the SoftMax Pro 7, software designed to provide the simplicity, flexibility and power required for advanced. Sold as-is. com. However, for greater flexibility, some instruments can accommodate 6- to 1536-well plate formats. Molecular Devices SpectraMax 340PC Microplate Spectrophotometer. Molecular Devices SpectraMax Plus 384. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Published Dec 16, 2020 | Updated Dec 16, 2020. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide range. SpectraMax M3, M4, M5, and M5e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. General-purpose refrigerators are ideal economical units for when precise temperature control and maintenance are not. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. Read one sample or up to 384 in a single plate read using any standard. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. SpectraMax® Plus 384 Absorbance Plate Reader, Molecular Devices. The SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. SUPPORTED PLATES Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax M2 and SpectraMax M2e. SpectraMax190reads96-wellplates. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. Detects signal from either fluorescence or luminescence based assays. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. The SpectraMax® M2 and M2e Systems from Molecular Devices are multidetection microplate readers with dualmonochromators, dual-mode cuvette ports, and top- and bottom-reading capability (top-reading only on the M2). When connecting for the first time to either the SpectraMax L reader or StakMax system. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. 0200-6262. SpectraMax Microplate Readers. Detection Cartridge (384) (PN 0200-7015) • SpectraMax Paradigm Glow Luminescence (LUM) Detection Cartridge (96) (PN 0200-7014) A glow luminescence detection cartridge contains the optics and electrical components needed to perform specific measurement modes or for specific applications. used. Item SpectraMax 340PC 384 Tunable Spectrophotometer with SoftMax Pro Software; Company Molecular Devices LLC; This product is no longer available on Biocompare. Videos & Webinars. What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. It measures the optical density (OD) of samples in both 96- and 384-well. This revolution in modularity makes no compromise detection the norm. ability to detect 16 ng/well of DNA and to quantitate 50 ng of . Molecular Devices’ SpectraMax® Plus 384 Microplate Reader provides fast and reliable full spectral range detection for cuvettes, 96-well and 384-well microplates. 003 fmol 0. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v1. Double-click the unknown device with the yellow warning icon. Page 28 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. 003 fmol 0. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Shaker time 0 to 999 seconds Temperature range Ambient +4°C to 45°C General specifications Dimensions (in. This kit is optimized for Molecular Devices384 wells, the SpectraMax iD3 reader is the complete solution for all your research needs. For more sample throughput, the system canThis version is compatible with the following instruments: SpectraMax® Mini Multi-Mode Microplate Reader (software version 7. PathCheck Sensor. 100 fmol 1536-well (8 µL) 0. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-ModeNote: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. Made from polypropylene with conical well profiles to maximize recovery and allow working with sample volumes as low as 5 µl. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2 . This integrated system. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10 Multimode Reader Comparison Chart. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. Fluorescence Microplate Reader Comparison Chart. Select the Driver tab and click Update Driver. The SpectraMax iD3 reader is fully compatible with the SpectraDrop™ Micro Volume Microplate, enabling quantitation of precious low volume samples. Charge heterogeneity with fast and simple CZE or with hi-res cIEF. Next generation SpectraMax® absorbance microplate readers. As a generous estimate, you might consider 300 W (at 120 Volts) per Spectramax reader, plus another 300 W for the Computer. SpectraMax i3x. Fluorescence filters included in 1nm range. The SpectraMax® M5 Multi-Mode Microplate Reader delivers single mode reader performance and can be equipped to read volumes as low as 2uL in one multimode reader package. Below is the list of Molecular Devices microplate readers and liquid handling instruments that are of out-of-production and are now considered obsolete. The Molecular Devices SpectraMax M3 Multi-Mode Microplate Reader is a dual-monochromator, multi-detection microplate reader with full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well. Detection modalities are shown in Table 1-1. Application note showing how SpectraMax® i3x and SpectraMax®iD5 Multi-Mode Microplate Readers are used to performGq-coupled receptor assays using HTRF technology. Note: Additional readers with similar performance are listed. Temperature control and shaking included as standard. Chapter 1: General Information. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. Model: SpectraMax PLUS 384. The EMax® Plus Microplate Reader is designed to be a versatile and robust plate reader for research laboratories. 305 reference level saturation. AlphaScreen and AlphaLisa detection using a 680 nm excitation laser diode and a 570/100 nm emission filter. 315 can't find zero order. Biocompare is the leading. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Accurate quantitation TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes acrossawiderangeofconcentrations. Five-mode microplate reading with superior optics Unique optical characteristics 1. Version7. 5 mP. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. Speed Read Mode. Expanding The Boundaries of Microplate Reader Functionality - The. dual monochRomatoRs foR assay flexibility With SpectraMax Multi-Mode Readers, there is no need to utilize expensive filters to optimize detection levels and background. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. For very concentrated samples, use a minimumThe ProcartaPlex 384-well format was specifically developed to increase sample throughput while maintaining the robustness of a 96-well assay. Our absorbance plate readers feature our PathCheck Sensor technology and. Also refer to this Multimode Reader Comparison Chart. The dual monochromator optics allow the widest range of applications to be utilized for bioresearch and drug discovery applications, all without the need to change. For more sample throughput, the system can be. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. These instruments measure the optical density (OD) of samples at selected wavelengths in a single read mode. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. QuickSync. 1. Microplate Readers. The SpectraMax® ABS Plus Microplate Reader can run . The reader adds up to three transfers of assay reagents from a 96- or 384-well source plate to enhance assay design using integrated fluidics. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. 1. Page 19: Plate Adapter SpectraMax M2 and M2e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. microplates or in a cuvette at a. The SoftMax® Pro Data Acquisition and Analysis Software controls Molecular Devices® spectrophotometers and absorbance, luminescence, and fluorescence microplate readers andThe absorbance at 450 nm was measured with a microplate reader (SPECTRAmax 384, Molecular Devices, United States). Products : SpectraMax M2/M2e reader, SpectraMax M5/M5e reader, Gemini XPS reader, FlexStation II (Obsolete), Gemini EM reader, FlexStation 3 reader. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. The value for 1000 should be higher than the value for 900. Instrument Description and Capabilities: Fluorescence. 190-1000 nm, tunable in 1 nm increments. Molecular Devices SpectraMax 384 Plus Microplate Reader. 과 같은 Parameter를 검사하여 평가할 수 있습니다. Temperature range between 4°C above ambient to 45°C. , FI 45 sec. Check the optical alignment, you will have to disassemble and remove optical cover. Molecular Devices SpectraMax Plus 384. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. microplates or in a cuvette at a selected. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 5 cm x. Beer-Lambert Law states that. Browse for different fluorescent readers below and compare across different instrument suppliers. Spectramax i3 manual. The transparency of BNC‒Mannitol and BNC‒Minimal membranes were examined by light transmittance within the UV–visible range (200–700 nm) using a SpectraMax 384 spectrophotometer (Molecular Devices, Sunnyvale, CA, USA). It measures the optical density (OD) of samples in both 96- and 384-well. Spectrophotometer 또는 Microplate Reader 상의 260nm에서 측정된 DNA 샘플의 흡광도는…. Tb donor/red acceptor. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Wavelength Range. 384 wells: Abs 49 sec. Wavelength Range. The SpectraMax M5e Reader offers the additional benefit of being certified for Cisbio Bioassays’ HTRF® Assays. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The optical performance is comparable to a top-of-the-line dedicatedDescription Microplates The SpectraMax Multi-Mode Microplate Reader can accommodate SBS- standard 6-well to 384-well microplates and strip wells. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold increase in throughput for medium throughput and secondary screening laboratories. The Spectramax 190 has an array of data collection modes, including kinetic, endpoint, and spectral scan modes. Title: SpectraMax i Series Multi-Mode Microplate Readers | Molecular Devices Author: Molecular Devices Subject: SpectraMax i Series offer the ideal solution for any application whether you are looking for an intuitive, easy-to-use reader, multi-user lab, or an upgradeable system that can adapt to support your lab s new projects. Biocompare is the leading resource for up-to-date product information, product reviews, and new technologies for life scientists. This product is no longer available on Biocompare. ‘StimB’ is Stimulation Buffer, included in the IP-One Gq kit. The SpectraMax® Gemini™ XPS Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. The SpectraMax M2 and M2e systems provide the multi detection microplate readers with dualmonochromators, dual-mode cuvette ports, with top & bottom reading. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and. The AlphaScreen Detection Cartridges utilize a 680nm Laser Diode to provide a sensitive reading system for AlphaScreen assays. If desired, a high-range standard curve may be prepared from 1 ng/mL to 1 μg/mL, or a low-range standard curve may be prepared from 25 pg/mL to 25 ng/mL. For more sample throughput, the system can be. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Details. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. All data were generated from at least three independent experiments (n ≥ 3). You manually lift up the lid over the chamber to insert or remove a cuvette. The PA 800 Plus system is a robust analytical, kit-based platform that can help you with: Purity/Heterogeneity with gold standard CE-SDS in minutes. It measures the optical density (OD) of samples in both 96- and 384-well. Tailored to your different needs, these kits are configured and optimized for Molecular Devices SpectraMax® microplate readers with preconfigured protocols provid- The SpectraMax® iD3 Multi Mode Microplate . and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. 2. ItThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Multimode Readers Comparison Chart. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. Key features 4 gain calibration failed. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. The following document is intended to demonstrate setup of this. Validate the optical performance of your absorbance . DNA provides the same sensitivity as a spectrophotometer. spr SpectraMax iD3 SpectraTest ABS2 v1. These VWR® Plus Series stainless steel refrigerators feature a multi-functional design for laboratory use. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. A & K Biosource are the pros on this, but these plate readers are quite expensive to repair/calibrate. Open the catalog to page 2. spr * SpectraMax i3(x) SpectraTest ABS2 v1. 00 USD Tecan Infinite 200 Pro M Plex Microplate Reader - AV $14,995. Molecular Devices SpectraMax 384 Plus Microplate Reader. . The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Reads standard cuvettes & 96-384 well plates from 190 to 1000 nm. Get the best deals for spectramax plus 384 at eBay. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Pick the best speed, sensitivity, and price for your needs. The Molecular Devices SpectraMAX absorbance microplate readers mimic a dual beam spectrophotometer with a patented multichannel optical design. Typically the system can detect absorbance, luminescence, fluorescence, and even make more specialized fluorescence measurements like time-resolved fluorescence (TRF) and fluorescence polarization (FP). For nearly 30 years, Molecular Devices has provided scientists with . Analyst, M5, Flex 3, and SpectraMax L readers work differently. For 40 years, we have partnered with scientists to help them achieve landmark discoveries. A microplate reader as The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes. PathCheck sensor corrects optical pathlength & pipetting variation. SpectraMax Plus 384 Spectrophotometer from Molecular Devices LLC. Assay Performance with Various Instrument Settings The SpectraMax® M2/M2e instruments use SoftMaxPro® DataSpectraMax® Microplate Readers and SoftMax® Pro Software. Three low volume 24-well bottom slides. Abs 49 sec. SpectraMax and VersaMax Plate Readers Operator’s Manual — 0112-0126 Rev A SpectraMax Plus384 SpectraMax 190 SpectraMax 340PC384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. 00 USDThe SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. Reads 96-well microplates in 5 seconds; Reads 384-well microplates in 16 seconds, Monochromator, tunable 1. By utilizing the optimized instrument settings suggested within this Application Note, Z' values > 0. The SpectraMax M4 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96 and 384-well microplates. Glycan analysis with award-winning Fast Glycan technology. to View Figures. Upon completion of a plate read, data are delivered to your computer in an Excel-compatible format. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. Ensure there are three inches between the back of the instrument and any other objects or surfaces so it has proper air flow. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Description Control Panel Cuvette Chamber Back Panel Microplate Drawer The Control Panel TEMP on/off TEMP Figure 1. FilterMax F3 and F5 Multi-Mode; SpectraMax Paradigm® Multi-Mode. Published Dec 16, 2020 | Updated Dec 16, 2020. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. 0 nm increments. 6 to 384-well plates, LVis Plate with sixteen 2 µL microspots; Get Quote. tools to expand the. Detection modalities are shown in Table 1-1. Molecular Devices Spectramax 384 Plus Microplate Reader is available from The Lab World Group. Glad to help you. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and. 2. Simply select the absorbance maximum of a sample and let the monochromator tune to that exact wavelength. The Molecular Devices SpectraMax® M5/M5e Microplate Reader was tested for compatibility with Life Technologies GeneBLAzer® assays. 303 unable to cal dark current. ) gap between the rear of the instrument and the wall. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 5 pM 2. Assay setup for a 384-well low-volume plate. Our microplateSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. microplates or in a cuvette at a. The SpectraMax® L Microplate Reader measures flash and glow luminescence assays in both 96- and 384-well plates. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2 e. Expanded wavelength coverage. Wavelength Selection: Monochromator, tunable 1. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. The optical system of the SpectraMax 190 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 850 nm). Annual recertification of your validation plates ensure that they meet specifications and give you confidence in the performance of your instrument. 76358-624. 더 많은. View the LabX ads below to find Molecular Devices SpectraMAX plate readers for sale and. Perform your favorite applications with a user-friendly reader that accommodates plate types from six to 384-well formats; up to. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. SpectraMax Gemini XPS/EM Register or Sign In. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and convenience for a wide range of assays such as ELISAs, nucleic acid and protein quantitation, and microbial growth. Detection of species collected on membrane plates is also possible. Minimum volume and maximum throughput with 96- or 384. Top or bottom detection is available at the touch of a button. SoftMax® Pro Software for Windows 10 and 11 is designed to provide the simplicity, flexibility and power required for advanced data analysis. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. SpectraMax i3x Multi-Mode Microplate Reader. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. The SpectraMax® and VersaMax™ require proper ventilation to keep their internal components cool. Vice President Sales and Marketing. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax iD3 reader with touchscreen and inserted USB flash drive. 5 pg/µL to 200 ng/µL. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. The AquaMax® Microplate Washer is a fully self-contained system, configurable for both 96- and 384-well microplates. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. Clearance . Choose cables that meet the requirement described in this appendix. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. , FI 45 sec. , FI 45 sec. SpectraMax® ABS Plus microplate reader can run both cuvette-based and microplate reader applications on the same instrument. Please see part number 6007619, sterile,. SpectraMax® 340PC384 Microplate Reader for acquiring data in endpoint, kinetic, and spectral scan modes using wavelegths from 340-850 nm, tunable in 1 nm increments. SpectraMax M2, M2e; SpectraMax M3, M4, M5, M5e; FilterMax™ Multi-Mode Detection Platform. Colorimetric assays. Light Source: Xenon flash lamp. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. Digital controller and display. Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. In addition, the SpectraMax iD5 The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. Wavelength Selection: Monochromator, tunable 1. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The SpectraMax® Plus 384 adds the ability to read cuvettes. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. together with SpectraMax, VersaMax, VMax, and EMax microplate readers from Molecular Devices, offer a quality assurance screening solution for the detection of melamine contamination in such food products as milk, infant formula, pet food, and confectionery. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. Sold as-is. Molecular Devices also offers a mass spectrometry-based solution for food safety testingThe SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M4 Microplate Reader transforms each well in a microplate to a fixed. All have an optical pathlength of 1 cm (10 mm) and standard external dimensions (12. Fluorescence Microplate Reader Comparison Chart. SoftMax® Pro Software is included and enables data visualized in 3D plots, gray scale, kinetic curve. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. Essentially, all UV/VIS spectrophotometric assays that are read in a conventional spectrophotometer or micro plate reader can be read in the SpectraMax Plus: DNA/RNA/protein quantitation and purity. With the QuickSync client installed on your computer, your SpectraMax iD3 reader can push data to any computer within the same network. 997 (n = 3). Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. 0 fluorometer; BioMicroLab – XL20 tube sorter; Biobus; Thermo Scientific – NanoDrop 2000 Spectrophotometer; Thermofisher – Qubit FluorometerSpectraMax® L和SpectraMax® M5酶标仪均为CellTiter-Glo检测提供了优异的检测灵敏度。SpectraMax® L化学发光读板机带有自动增益功能,能同时进行模拟信号和光子计数,提供大于9个数量级的动态范围,对于高信号值样品无需稀释,同时对于低信号样品具有优越的灵敏度。After 3× washing, the plates were developed with ABTS substrate (Moss) and analyzed on a SpectraMax Plus 384 spectrophotometer (Molecular Devices) at optical density (OD) 405 nm. Monochromator wavelength selection saves you the time and trouble of ever having to. no. Optimized for 96- and 384-well plates, the Multi-Mode Detection Cartridge provides a broad array of measurement capabilities: Fluorescence Intensity (FI), Time. SpectraMax ® Plus 384 optics. These models can no longer be repaired. The . Assay Kits. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. com Check our website for a current listing of worldwide distributors. Cell viability는 세포막 Integrity 또는. Insert the snorkel into the bottle and then insert the snorkel into the snorkel clamp. Applications. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export data The SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. The SpectraMax Plus 384 reader is equipped with an innovation patented by Molecular Devices, the PathCheck® sensor, which measures the depth of a sample in a microplate by optical path length. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. Robust. The light should fall square on the slit. 세포신호전달은 세포가 환경에 반응하고 다른 세포와 소통할 수 있게 합니다…. Wavelength(s): 230 to 750 nm (depending on model) Features: Shaking, Temperature Control. 2. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. <p>384-well transparent tissue-culture treated (TC-treated) microplate for cell-based absorbance (colorimetric) assays. The instrument reads any standard cuvette, microcuvette, test tube or 96- and 384-well standard or UV transparent microplate over a full 190 to 1000. If desired, the samples can be transferred into cuvettes before reading. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. The optical performance is comparable to a top-of-the-line dedicated Unparalleled performance on a personalized platform. SpectraMax® M5e Multi-Mode Microplate Reader performance with an integrated 8- or 16-channel pipettor into one compact benchtop reader. Community forums for Molecular Devices - SpectraMax Plus. Molecular Devices Spectramax. Clearance . 304 signal level saturation. The SpectraMax® 340PC384 Reader from Molecular Devices provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro Data Acquisition and Analysis Software. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Customize data collection and analysis. The SpectraMax® Gemini™ EM Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. mRNA purity and integrity analysis. spr SpectraMax Plus 384. 5014038F 3 Contents SafetyInformation 5 Warnings,Cautions,Notes,andTips 5 Chapter1:Introduction 11 ComputerIntegration 11 Applications 12 DualPhotomultiplierTubes 12For SpectraMax iD5, i3x, and Mini readers, the read height setting should be optimized for the microplate used. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Use any standard cuvette, 12 xSpectraMax® iD3 and iD5 Multi-Mode Microplate Readers can measure absorbance, fluorescence and luminescence.